GET /api/protein/UniProt/D3HPG1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D3HPG1",
"id": "D3HPG1_LEGLN",
"source_organism": {
"taxId": "661367",
"scientificName": "Legionella longbeachae serogroup 1 (strain NSW150)",
"fullName": "Legionella longbeachae serogroup 1 (strain NSW150)"
},
"name": "Putative HlyD family secretion protein",
"description": null,
"length": 280,
"sequence": "MGKMRNLLFIGLITLLLISCNKKENKLFSGYIDANLVYLSADFGGRLTDLPISKGQVVKKNQFLFKLEQTNELYNVKMSQLGTKELLAQRQQILTQLNYNEINYRRVVVMRQQNAASQSDLDAAQRDLNISKQQLDDINTKIKSNQVDVADKKWFVSRKENFAPEYGIIFDTYYTQGEFVQAGIPILSLITKKNIKAIFFAPEEKLSHLRLNEQIKIKTDQNTHLATGHISYISNIAEYTPPIIYSREERQRLVFRIEVQINSPDLEKIHLGQPVTLELA",
"proteome": "UP000001060",
"gene": "LLO_0444",
"go_terms": [
{
"identifier": "GO:1990961",
"name": "xenobiotic detoxification by transmembrane export across the plasma membrane",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0019898",
"name": "extrinsic component of membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:1990195",
"name": "macrolide transmembrane transporter complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"ssf": 1,
"cathgene3d": 2,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1
}
}
}