General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D3HPG1",
        "id": "D3HPG1_LEGLN",
        "source_organism": {
            "taxId": "661367",
            "scientificName": "Legionella longbeachae serogroup 1 (strain NSW150)",
            "fullName": "Legionella longbeachae serogroup 1 (strain NSW150)"
        },
        "name": "Putative HlyD family secretion protein",
        "description": null,
        "length": 280,
        "sequence": "MGKMRNLLFIGLITLLLISCNKKENKLFSGYIDANLVYLSADFGGRLTDLPISKGQVVKKNQFLFKLEQTNELYNVKMSQLGTKELLAQRQQILTQLNYNEINYRRVVVMRQQNAASQSDLDAAQRDLNISKQQLDDINTKIKSNQVDVADKKWFVSRKENFAPEYGIIFDTYYTQGEFVQAGIPILSLITKKNIKAIFFAPEEKLSHLRLNEQIKIKTDQNTHLATGHISYISNIAEYTPPIIYSREERQRLVFRIEVQINSPDLEKIHLGQPVTLELA",
        "proteome": "UP000001060",
        "gene": "LLO_0444",
        "go_terms": [
            {
                "identifier": "GO:1990961",
                "name": "xenobiotic detoxification by transmembrane export across the plasma membrane",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019898",
                "name": "extrinsic component of membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:1990195",
                "name": "macrolide transmembrane transporter complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 2,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}