General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D2RL51",
        "id": "D2RL51_ACIFV",
        "source_organism": {
            "taxId": "591001",
            "scientificName": "Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / CCUG 9996 / CIP 106432 / VR4)",
            "fullName": "Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / CCUG 9996 / CIP 106432 / VR4)"
        },
        "name": "Peptidyl-tRNA hydrolase",
        "description": [
            "Catalyzes the release of premature peptidyl moieties from peptidyl-tRNA molecules trapped in stalled 50S ribosomal subunits, and thus maintains levels of free tRNAs and 50S ribosomes",
            "Hydrolyzes ribosome-free peptidyl-tRNAs (with 1 or more amino acids incorporated), which drop off the ribosome during protein synthesis, or as a result of ribosome stalling"
        ],
        "length": 209,
        "sequence": "MKLVVALGNIGREYAGTRHNIGFMTADLLAERWGDTEAWRKADNAFYLEKRMPEKCWVIKPTTYMNNSGVAVADFANFYHIPPEDVLVIQDDMDLPVGTLRIRRKGSSGGHNGLKSIERALGSQAYPRIKVGIGHPVHQEQAVISHVLHPFQREDKEKVQEALDQAADAVEAWMKGAAVGELMQQFNKKAPKKPKTEKVPSEEAKENAQ",
        "proteome": "UP000001902",
        "gene": "pth",
        "go_terms": [
            {
                "identifier": "GO:0004045",
                "name": "peptidyl-tRNA hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0acd99499c4bfe704cf6014f6a6b377ddb2d2159",
        "counters": {
            "domain_architectures": 31239,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 31239
        }
    }
}