GET /api/protein/UniProt/D2QQF3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D2QQF3",
        "id": "D2QQF3_SPILD",
        "source_organism": {
            "taxId": "504472",
            "scientificName": "Spirosoma linguale (strain ATCC 33905 / DSM 74 / LMG 10896 / Claus 1)",
            "fullName": "Spirosoma linguale (strain ATCC 33905 / DSM 74 / LMG 10896 / Claus 1)"
        },
        "name": "Cell division protein FtsZ",
        "description": [
            "Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity"
        ],
        "length": 480,
        "sequence": "MNSQGYRFELPDDNPIIIKVVGVGGMGGNAVKHMHKLKMQDVSFAVCNTDRQALMSNPVPTKLQLGDGLGAGTEAKAGEDAARASLEEIRNLLAPPTKMVFITAGMGGGTGTGAAPVVAEVAREMGLLTVAVVTAPYWYEGTDKKEQAREGIEKLKKSCDTVLVVLNDKLAELYSELTWTEAYAHADDVLANAVKSIAEIITTQGDINADFADVKKVLEQAGQSVMGSAEVSGEDRALRAIEAALNSPLLNDHDIRGAKRILLTISSSKEHAMRLKEQMAISEHVAKKIQNEAKMFKFGAITDDALGESLRVTIIAAGFDGTTTLMEQLKDTSVQNTPAPVEPDPEPEILPQEPFMQPEPVNELVLVADDGEEIDPNPVSLSTKIDDKQTPTGYNGTTIIRPETPGIIRPLPHDDSDVLLLDDEERPNDADMIKRMVDAFVKGQYLAADLDRPTFERNKTMLYSLPMLSEQEFVRSKLND",
        "proteome": "UP000002028",
        "gene": "ftsZ",
        "go_terms": [
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003924",
                "name": "GTPase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cbbeeb35c1609cb87cda9690287a256c6f6af835",
        "counters": {
            "domain_architectures": 30661,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 2,
                "pfam": 2,
                "ssf": 2,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 30661
        }
    }
}