GET /api/protein/UniProt/D2Q4H5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D2Q4H5",
        "id": "PSA_KRIFD",
        "source_organism": {
            "taxId": "479435",
            "scientificName": "Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399)",
            "fullName": "Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399)"
        },
        "name": "Proteasome subunit alpha",
        "description": [
            "Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation"
        ],
        "length": 283,
        "sequence": "MSTPFYVSPEQLMRDRADFARKGIAKGRSAIALQYADGILFVAENRSPALHKVAEIYDRMAFAAVGRYNEFENLRIAGVRLADMRGYSYDRRDVTGRALANAYAQTLGAIFSSGGEKPLEVEILVAEVGTTAADDQIYRLTYDGSIADVRGYAVMGGPAEQVADYVGEHYQEGISLAGALRLAVDALGHDSSEVRQLEPDQIEVAVLDRTRTQVRKFKRISDQTLARILSESRPDTAPSPESSAHTEETETVDGGSYESAAGTSAADDAPIAPPEDPDDNRPL",
        "proteome": "UP000007967",
        "gene": "prcA",
        "go_terms": [
            {
                "identifier": "GO:0030163",
                "name": "protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005839",
                "name": "proteasome core complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004298",
                "name": "threonine-type endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019773",
                "name": "proteasome core complex, alpha-subunit complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d0cadb4b1c9d733ad28db3ac45300c7c0dc1b432",
        "counters": {
            "domain_architectures": 65712,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 65712
        }
    }
}