GET /api/protein/UniProt/D2NNR4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D2NNR4",
        "id": "D2NNR4_ROTMD",
        "source_organism": {
            "taxId": "680646",
            "scientificName": "Rothia mucilaginosa (strain DY-18)",
            "fullName": "Rothia mucilaginosa (strain DY-18)"
        },
        "name": "tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase",
        "description": [
            "Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at position 37 in tRNAs that read codons beginning with uridine"
        ],
        "length": 504,
        "sequence": "MTSTLSDSAQTPETSPRTYEVRTFGCQMNVHDSERMSGLLEANGYVRAEEGTQPDLVVFNTCAVRENASNRLYGNLGQLAPVKRAHKGMQIAVGGCLAQKDQDAIIEKAPWVDVVFGTHNIGALPTLLERARHNHEAQAELLESLEVFPSTLPTKRDHVYSGWVSISVGCNNTCTFCIVPSLRGKEKDRRPGDILAEVQALVDDGAIEVTLLGQNVNSYGVEFGDRQAFSKLLRACGEIEGLERVRFTSPHPAMFTDDVIDAMAETPNVMPVLHMPLQSGSDKVLKDMRRSYRSKKFLNILEKVRERIPNAVITTDIIVGFPGETEEDFQDTLKVVEQARFSSAFTFQYSIRPGTPAATMENQIPKEVVQERYERLIALQDRIAGEENRKQLGKTVELMVVAEAGRKAEQTHRLSGRGPDQRLVHFSVPEGCETPRPGDMVTVPITEAGSFHLISDPTAEQYQLRRTRAGDAWDRSQADSCGTGTTQVPGAPVGLGMPTIGLRP",
        "proteome": "UP000001883",
        "gene": "miaB",
        "go_terms": [
            {
                "identifier": "GO:0035596",
                "name": "methylthiotransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016740",
                "name": "transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006400",
                "name": "tRNA modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6c45c6d2798f5e3bef466d8ce7e2d68e5853059e",
        "counters": {
            "domain_architectures": 18732,
            "entries": 29,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 3,
                "cathgene3d": 2,
                "ssf": 1,
                "smart": 1,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "sfld": 4,
                "hamap": 1,
                "ncbifam": 2,
                "prosite": 1,
                "interpro": 10
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 18732
        }
    }
}