HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D2NNR4",
"id": "D2NNR4_ROTMD",
"source_organism": {
"taxId": "680646",
"scientificName": "Rothia mucilaginosa (strain DY-18)",
"fullName": "Rothia mucilaginosa (strain DY-18)"
},
"name": "tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase",
"description": [
"Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6-(dimethylallyl)adenosine (ms(2)i(6)A) at position 37 in tRNAs that read codons beginning with uridine"
],
"length": 504,
"sequence": "MTSTLSDSAQTPETSPRTYEVRTFGCQMNVHDSERMSGLLEANGYVRAEEGTQPDLVVFNTCAVRENASNRLYGNLGQLAPVKRAHKGMQIAVGGCLAQKDQDAIIEKAPWVDVVFGTHNIGALPTLLERARHNHEAQAELLESLEVFPSTLPTKRDHVYSGWVSISVGCNNTCTFCIVPSLRGKEKDRRPGDILAEVQALVDDGAIEVTLLGQNVNSYGVEFGDRQAFSKLLRACGEIEGLERVRFTSPHPAMFTDDVIDAMAETPNVMPVLHMPLQSGSDKVLKDMRRSYRSKKFLNILEKVRERIPNAVITTDIIVGFPGETEEDFQDTLKVVEQARFSSAFTFQYSIRPGTPAATMENQIPKEVVQERYERLIALQDRIAGEENRKQLGKTVELMVVAEAGRKAEQTHRLSGRGPDQRLVHFSVPEGCETPRPGDMVTVPITEAGSFHLISDPTAEQYQLRRTRAGDAWDRSQADSCGTGTTQVPGAPVGLGMPTIGLRP",
"proteome": "UP000001883",
"gene": "miaB",
"go_terms": [
{
"identifier": "GO:0035596",
"name": "methylthiotransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051539",
"name": "4 iron, 4 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016740",
"name": "transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006400",
"name": "tRNA modification",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6c45c6d2798f5e3bef466d8ce7e2d68e5853059e",
"counters": {
"domain_architectures": 18732,
"entries": 29,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 3,
"cathgene3d": 2,
"ssf": 1,
"smart": 1,
"pfam": 2,
"cdd": 1,
"panther": 1,
"sfld": 4,
"hamap": 1,
"ncbifam": 2,
"prosite": 1,
"interpro": 10
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 18732
}
}
}