General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D2I2H6",
        "id": "D2I2H6_AILME",
        "source_organism": {
            "taxId": "9646",
            "scientificName": "Ailuropoda melanoleuca",
            "fullName": "Ailuropoda melanoleuca (Giant panda)"
        },
        "name": "2-hydroxyacylsphingosine 1-beta-galactosyltransferase",
        "description": [
            "Catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Galactosylates both hydroxy- and non-hydroxy fatty acid-containing ceramides and diglycerides"
        ],
        "length": 541,
        "sequence": "MKSYTPYFMLLWSAVGIAKAAKIIIVPPIMFESHMYIFKTLASALHERGHRTVFLLSEGRDIAPSNRYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAMELFDILDHYTKNCDMVVGNRALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDHMNLLQRMKNTGVYLISRLGVSFLVLPKYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPAGPLPEDLQRWVNGANEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGTKPKNLGNNTKLIEWLPQNDLLGHSNIKAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWKTVTEGELYEALVEVINNPSYRQRAQKLSEIHKDQPGHPVNRTVYWIDYILRHNGAHHLRAAVHQISFCQYFLLDIAFVLLLGAALFYFFLSWVTKFIYRKIKSLWSRNKHSTVNGHYHNGILNGKYKRNGHIKHEKKVK",
        "proteome": "UP000008912",
        "gene": "UGT8",
        "go_terms": [
            {
                "identifier": "GO:0008194",
                "name": "UDP-glycosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "781f331c11f55b381926aa2b09b4b07d5b4d0620",
        "counters": {
            "domain_architectures": 97521,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 97521
        }
    }
}