HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D2HGN0",
"id": "D2HGN0_AILME",
"source_organism": {
"taxId": "9646",
"scientificName": "Ailuropoda melanoleuca",
"fullName": "Ailuropoda melanoleuca (Giant panda)"
},
"name": "Rhodopsin",
"description": [
"Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling"
],
"length": 348,
"sequence": "MNGTEGPNFYVPFSNKTGVVRSPFESPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVANLFMVFGGFTSTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFSIPMIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVVIMVIAFLICWLPYAGVAFYIFTHQGSNFGPIFMTIPAFFAKSSSIYNPVIYIMMNKQFRNCMITTLCCGKNPLGDDEASASASKTETSQVAPA",
"proteome": "UP000008912",
"gene": "RHO",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0004930",
"name": "G protein-coupled receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007186",
"name": "G protein-coupled receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0007602",
"name": "phototransduction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0007601",
"name": "visual perception",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b0aaad84f30c5d22b36ddf47296ce1f96317f5a2",
"counters": {
"domain_architectures": 6906,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 2,
"cdd": 1,
"profile": 1,
"panther": 1,
"prosite": 2,
"prints": 3,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6906
}
}
}