General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D2H325",
        "id": "D2H325_AILME",
        "source_organism": {
            "taxId": "9646",
            "scientificName": "Ailuropoda melanoleuca",
            "fullName": "Ailuropoda melanoleuca (Giant panda)"
        },
        "name": "EEF1A lysine methyltransferase 3",
        "description": [
            "Protein-lysine methyltransferase that selectively mono-, di- and trimethylates 'Lys-165' of the translation elongation factors EEF1A1 and EEF1A2 in an aminoacyl-tRNA and GTP-dependent manner. EEF1A1 methylation by EEF1AKMT3 is dynamic as well as inducible by stress conditions, such as ER-stress, and plays a regulatory role on mRNA translation"
        ],
        "length": 226,
        "sequence": "MADPCPDRESEPESVFPREVGLFADFYSEKSRFCFCGHVLSITQNFGSRLGVAARVWDAALSLCNYFESQNVDFRGKKVIELGAGTGIVGILAALQGGDVTITDLPVALEQIQGNVQANVPAGGRAQVCALSWGIDQHVFPGDYDLVLGADIVYLEPTFPLLLGTLQHLCGPHGTVYLASKMREEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHREPRPA",
        "proteome": "UP000008912",
        "gene": "EEF1AKMT3",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d85bd1bd28376eba4c7f1f123f68489110ca4687",
        "counters": {
            "domain_architectures": 34527,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 34527
        }
    }
}