GET /api/protein/UniProt/D2DIN8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D2DIN8",
        "id": "D2DIN8_9CHLR",
        "source_organism": {
            "taxId": "662657",
            "scientificName": "uncultured Chloroflexi bacterium 1i19",
            "fullName": "uncultured Chloroflexi bacterium 1i19"
        },
        "name": "Cytidine deaminase",
        "description": [
            "This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis"
        ],
        "length": 128,
        "sequence": "MNATVSPQQLVAAAHSARKQAYAPYSNYAVGAAVLTENGEIIPGCNVENASYGGTICAERVALTSAIAQGKRRLTAIAVVTVDGGSPCGFCRQVMVELGVDMDVYISDAAGNFRSTTVRALLPDAFGA",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0004126",
                "name": "cytidine deaminase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f99539802ad74cdae12e721eaf57a43643662eeb",
        "counters": {
            "domain_architectures": 85233,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 2,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 85233
        }
    }
}