HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D2DIN8",
"id": "D2DIN8_9CHLR",
"source_organism": {
"taxId": "662657",
"scientificName": "uncultured Chloroflexi bacterium 1i19",
"fullName": "uncultured Chloroflexi bacterium 1i19"
},
"name": "Cytidine deaminase",
"description": [
"This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis"
],
"length": 128,
"sequence": "MNATVSPQQLVAAAHSARKQAYAPYSNYAVGAAVLTENGEIIPGCNVENASYGGTICAERVALTSAIAQGKRRLTAIAVVTVDGGSPCGFCRQVMVELGVDMDVYISDAAGNFRSTTVRALLPDAFGA",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0004126",
"name": "cytidine deaminase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f99539802ad74cdae12e721eaf57a43643662eeb",
"counters": {
"domain_architectures": 85233,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"pfam": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 2,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 85233
}
}
}