General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D2CRL7",
        "id": "D2CRL7_DUVV",
        "source_organism": {
            "taxId": "38767",
            "scientificName": "Duvenhage virus",
            "fullName": "Duvenhage virus (DUVV)"
        },
        "name": "Phosphoprotein",
        "description": [
            "Non catalytic polymerase cofactor and regulatory protein that plays a role in viral transcription and replication. Stabilizes the RNA polymerase L to the N-RNA template and binds the soluble protein N, preventing it from encapsidating non-genomic RNA. Also inhibits host IFN-alpha and IFN-beta signaling by binding and retaining phosphorylated STAT1 in the cytoplasm or by inhibiting the DNA binding of STAT1 in the nucleus"
        ],
        "length": 298,
        "sequence": "MSKIFINPSDIRSGLADLEMAEETVELVNRNIEDSQAHLQGVPIDVETLPEDIQRLHITDPQASLRQDMVDEQKHQEDEDFYLTGRENPLSPFQTHLDAIGLRIVRKMKTGEGFFKIWSQAVEDIVSYVALNFSIPVNKLFEDKSTQTVTEKSQQAPASSAPNRHEKSSQNARVNSKDASGPAALDWTASNEADDESVEAEIAHQIAESFSKKYKFPSRSSGIFLWNFEQLKMNLDEIVREVKEIPGVIKMAKDGMKLPLRCMLGGVASTHSRRFQILVNPEKLGKVMQEDLDKYLTY",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003968",
                "name": "RNA-directed RNA polymerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019083",
                "name": "viral transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "a28768b8afa9796f7573a4ee0423680fff7e371e",
        "counters": {
            "domain_architectures": 1899,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1899
        }
    }
}