General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D2C3M4",
        "id": "D2C3M4_THEP2",
        "source_organism": {
            "taxId": "590168",
            "scientificName": "Thermotoga petrophila (strain ATCC BAA-489 / DSM 13996 / JCM 10882 / RKU-10)",
            "fullName": "Thermotoga petrophila (strain ATCC BAA-489 / DSM 13996 / JCM 10882 / RKU-10)"
        },
        "name": "Signal recognition particle protein",
        "description": [
            "Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds to the hydrophobic signal sequence of the ribosome-nascent chain (RNC) as it emerges from the ribosomes. The SRP-RNC complex is then targeted to the cytoplasmic membrane where it interacts with the SRP receptor FtsY"
        ],
        "length": 433,
        "sequence": "MFENLQEKLSRVFKNLSGRGKITEKNVKDAIREVKLSLLEADVNYKVVKEFVDHVLQKALGEEVLRSLTPDQQFIKIVRDELVRIMGEKNEPLRLVHRPAPIMMVGLQGSGKTTTCAKLAKLLKKEGRNPLLVAADLYRPAAVDQLVKLGNQIGVNVVHDYNKTPVEIVKEAVDVAESTGKDILIVDTAGRLHIDEEMMKELEEIKKILNPDEILLVVDAMMGQDAVNTAKVFDERLDLTGFVVTKMDGDARGGVILSIKYVTGKPVKFIGTSEKIDGLEPFHPDRIANRILGMGDVLSLIEKVEKELDQEKMKKSAEKFLKAEFTLEDFKEQLQEMKKLGPLSSILEMLPGAPKVDVEMSEKELKKIEAIINSMTIEERRNPGIINASRKRRIARGSGTTVQDVNKLLKSYEQMKALMKRMKKGRFKIPFGF",
        "proteome": "UP000000940",
        "gene": "ffh",
        "go_terms": [
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006614",
                "name": "SRP-dependent cotranslational protein targeting to membrane",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008312",
                "name": "7S RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0048500",
                "name": "signal recognition particle",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0003924",
                "name": "GTPase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c3545bf13d1896398eed4c329e7114d163be4ce5",
        "counters": {
            "domain_architectures": 30199,
            "entries": 25,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 3,
                "cathgene3d": 3,
                "pfam": 3,
                "ssf": 2,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 30199
        }
    }
}