HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D2C3M4",
"id": "D2C3M4_THEP2",
"source_organism": {
"taxId": "590168",
"scientificName": "Thermotoga petrophila (strain ATCC BAA-489 / DSM 13996 / JCM 10882 / RKU-10)",
"fullName": "Thermotoga petrophila (strain ATCC BAA-489 / DSM 13996 / JCM 10882 / RKU-10)"
},
"name": "Signal recognition particle protein",
"description": [
"Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds to the hydrophobic signal sequence of the ribosome-nascent chain (RNC) as it emerges from the ribosomes. The SRP-RNC complex is then targeted to the cytoplasmic membrane where it interacts with the SRP receptor FtsY"
],
"length": 433,
"sequence": "MFENLQEKLSRVFKNLSGRGKITEKNVKDAIREVKLSLLEADVNYKVVKEFVDHVLQKALGEEVLRSLTPDQQFIKIVRDELVRIMGEKNEPLRLVHRPAPIMMVGLQGSGKTTTCAKLAKLLKKEGRNPLLVAADLYRPAAVDQLVKLGNQIGVNVVHDYNKTPVEIVKEAVDVAESTGKDILIVDTAGRLHIDEEMMKELEEIKKILNPDEILLVVDAMMGQDAVNTAKVFDERLDLTGFVVTKMDGDARGGVILSIKYVTGKPVKFIGTSEKIDGLEPFHPDRIANRILGMGDVLSLIEKVEKELDQEKMKKSAEKFLKAEFTLEDFKEQLQEMKKLGPLSSILEMLPGAPKVDVEMSEKELKKIEAIINSMTIEERRNPGIINASRKRRIARGSGTTVQDVNKLLKSYEQMKALMKRMKKGRFKIPFGF",
"proteome": "UP000000940",
"gene": "ffh",
"go_terms": [
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006614",
"name": "SRP-dependent cotranslational protein targeting to membrane",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008312",
"name": "7S RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0048500",
"name": "signal recognition particle",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0003924",
"name": "GTPase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c3545bf13d1896398eed4c329e7114d163be4ce5",
"counters": {
"domain_architectures": 30199,
"entries": 25,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 3,
"cathgene3d": 3,
"pfam": 3,
"ssf": 2,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"prosite": 1,
"interpro": 9
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 30199
}
}
}