GET /api/protein/UniProt/D1Z353/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D1Z353",
        "id": "D1Z353_PIRVV",
        "source_organism": {
            "taxId": "3052324",
            "scientificName": "Pirital mammarenavirus (isolate Rat/Venezuela/VAV-488/1995)",
            "fullName": "Pirital mammarenavirus (isolate Rat/Venezuela/VAV-488/1995) (PIRV)"
        },
        "name": "Nucleoprotein",
        "description": [
            "Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. The increased presence of protein N in host cell does not seem to trigger the switch from transcription to replication as observed in other negative strain RNA viruses. Through the interaction with host IKBKE, strongly inhibits the phosphorylation and nuclear translocation of host IRF3, a protein involved in interferon activation pathway, leading to the inhibition of interferon-beta and IRF3-dependent promoters activation. Also encodes a functional 3'-5' exoribonuclease that degrades preferentially dsRNA substrates and thereby participates in the suppression of interferon induction",
            "Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. The increased presence of protein N in host cell does not seem to trigger the switch from transcription to replication as observed in other negative strain RNA viruses. Through the interaction with host IKBKE, strongly inhibits the phosphorylation and nuclear translocation of host IRF3, a protein involved in interferon activation pathway, leading to the inhibition of interferon-beta and IRF3-dependent promoters activation. Encodes also a functional 3'-5' exoribonuclease that degrades preferentially dsRNA substrates and thereby participates in the suppression of interferon induction"
        ],
        "length": 560,
        "sequence": "MASDNVASFRWTQALRRGLSNWTNPVKSDVITDTKALLAALDFDRVAQVQRLMRKDKRTDADLTKLRDLNKEVDALMNMRTTQKDNVLKVGGLSKDELMELASDLQKLKKKVLRAEGSGQPGVYAGNLTTTQLEQRTRILRDMGFAQLRGNPSGVVKVWDIKDSSLLINQFGSMPAVTMACMTEQGGEPLNDVVQGLTALGLLYTVKYPNMSDLEKLSDQYPCLSYITQEQSQINVSGYNLSLSAAVKAGACMLDGGNMLETINVKPTMFSSVIKAVLEVKSREKMFVSEIPGQRNPYENLLYKLCLSGDGWPYIGSRSQIKGRAWDNTTVDLSDTGSPNHPPVRNGGPPRLSQLSHAREEQILEGLKRLDSKATTWIDIEGTPNDPVELAIFQPESGSYIHCYREPHDVKSFKDQSKYSHGMLLKDLTNTQPGLISFIIKNLPAGIVLTAQGSDDIERLLEMHARRDISIIDVRLTAEQARQFEDKVWDKYGVLCNKHKGIVLARKKKGSPPGSKNPHCALLDCIMFCSTIGGFVDDKKPTRLLPLDVLYREQASLIEL",
        "proteome": null,
        "gene": "N",
        "go_terms": [
            {
                "identifier": "GO:0019013",
                "name": "viral nucleocapsid",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "d6f8f2853ff1953d791cd2be12d981d340052606",
        "counters": {
            "domain_architectures": 1224,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 2,
                "hamap": 1,
                "pirsf": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1224
        }
    }
}