HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D1PV20",
"id": "D1PV20_9BACT",
"source_organism": {
"taxId": "585502",
"scientificName": "Hallella bergensis DSM 17361",
"fullName": "Hallella bergensis DSM 17361"
},
"name": "Pyrophosphate--fructose 6-phosphate 1-phosphotransferase",
"description": [
"Catalyzes the phosphorylation of D-fructose 6-phosphate, the first committing step of glycolysis. Uses inorganic phosphate (PPi) as phosphoryl donor instead of ATP like common ATP-dependent phosphofructokinases (ATP-PFKs), which renders the reaction reversible, and can thus function both in glycolysis and gluconeogenesis. Consistently, PPi-PFK can replace the enzymes of both the forward (ATP-PFK) and reverse (fructose-bisphosphatase (FBPase)) reactions"
],
"length": 549,
"sequence": "MKASLLQKARAHYQPKLPKALVGAVKVREGETTQSVGDQDEIKKLFPHTYGLPVIHFVPGEERIGMKMNVGVILSGGQAPGGHNVICGIFDAVKAQNPENKVYGFLMGPSGLIEHDYKELTEEYVESYRNTGGFDMIGSGRTKLEKEDQFEKGREILEKLNIKALIIIGGDDSNTNACVLAEYYAAKKYGIQVIGCPKTIDGDLKNEQIETSFGFDTATKVYSELIGNIERDANSARKYWHFIKVMGRSASHIALECALQTQPNVCLISEEIEAKDMTLNQVVEQLAAVVAKRAEDGNNYGVVLVPEGLIEFVPAIGRLIDELNDLLAAHGADYRDLDEDAQRAYILEHLSKENAATFETLPNSVAHQLSLERDPHGNVQVSLIETEKLLSDMVADKLEKWKAEGKYNGSFATLHHFFGYEGRCAAPSNFDADYCYALGVSAANLIANGKTGYMAIVRNLSAPAEEWEAGGVPITMMLNMERRNGEMKPVIRKALVELEGAPFKKFVEKRDEFARNTCFVYPGPIQYWGPTEVSDRETRTLALENANRK",
"proteome": "UP000003160",
"gene": "pfk",
"go_terms": [
{
"identifier": "GO:0003872",
"name": "6-phosphofructokinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006096",
"name": "glycolytic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0047334",
"name": "diphosphate-fructose-6-phosphate 1-phosphotransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006002",
"name": "fructose 6-phosphate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c47239981a029609f58ab64a8107d57cef15dd9e",
"counters": {
"domain_architectures": 37322,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 3,
"pfam": 1,
"hamap": 1,
"ncbifam": 2,
"pirsf": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 37322
}
}
}