GET /api/protein/UniProt/D1AG78/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D1AG78",
"id": "D1AG78_SEBTE",
"source_organism": {
"taxId": "526218",
"scientificName": "Sebaldella termitidis (strain ATCC 33386 / NCTC 11300)",
"fullName": "Sebaldella termitidis (strain ATCC 33386 / NCTC 11300)"
},
"name": "Permease IIC component",
"description": [
"The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane"
],
"length": 420,
"sequence": "MIKFIENKLVPILIKIGENKILVAVRNGITLTLPFTISGSLFLILANLPIPGWSDFLGPFADKLSAPVAVTFGAIGIISAIGISYNLAKQYKLDAITCSAITMVVFLLAQLDQEYTLNVDNLGAAGLFSAIILSIITVHIIKFFISRNIVIKLPEGVPPAVAQSFAGLVPAAVAIVLIWFIRVLLNFDINAFFTWLLSPLVMGLGTLPGMLILIFLISILWCCGIHGDNVLSGITSPIFLKYIAENTQAYLNHQPIPHITADGFYIVFMCLGGTGATLGLVISMLRSKSKLYKSVGELSLPSAIFCINEPVIFGFPIVFNPIMMIPFTITPMILCTLTYALMYFNIIGRPVLQIPWTMPPIFAAYFVTGGNIPAVIWSVCTIVISVFVFLPFFKMAEKKQLEKEEAESRENLEPVLNSEI",
"proteome": "UP000000845",
"gene": "Sterm_3870",
"go_terms": [
{
"identifier": "GO:0008982",
"name": "protein-N(PI)-phosphohistidine-sugar phosphotransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009401",
"name": "phosphoenolpyruvate-dependent sugar phosphotransferase system",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e44151878caabaa92bbd0ce5cc1197c17863da6b",
"counters": {
"domain_architectures": 21575,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"pirsf": 1,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 21575
}
}
}