General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D0QB55",
        "id": "D0QB55_VACMY",
        "source_organism": {
            "taxId": "180763",
            "scientificName": "Vaccinium myrtillus",
            "fullName": "Vaccinium myrtillus (European blueberry)"
        },
        "name": "TDR4/Ful-like MADS-box protein",
        "description": [
            "Probable transcription factor"
        ],
        "length": 255,
        "sequence": "MGRGRVQMKRIENKVSRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSTHSSMESILEKYESYSYAERQLVATNSESQTNWNLEYPKLKARIEVLQRNIRHYVGEDLDTLTLRELQSVEQQIDTALKRIRSKKNQLVHESISDLQKKQKLLQEQNNQLAKKIKENEKTLAERAEQQNQGGQSSSTLVLPQLPPQPPQPPRPRPPPFHSLTIGGPFQARGTGDGGAQSHPPSNTLMPPWMLRHGNR",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000977",
                "name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045944",
                "name": "positive regulation of transcription by RNA polymerase II",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "147d9c25ec6bd472e0fad0821e87714677aaf04e",
        "counters": {
            "domain_architectures": 22750,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "profile": 2,
                "cdd": 1,
                "ssf": 1,
                "pfam": 2,
                "cathgene3d": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 22750
        }
    }
}