General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D0KTN1",
        "id": "D0KTN1_SACS9",
        "source_organism": {
            "taxId": "555311",
            "scientificName": "Saccharolobus solfataricus (strain 98/2)",
            "fullName": "Saccharolobus solfataricus (strain 98/2)"
        },
        "name": "DNA-directed RNA polymerase subunit Rpo6",
        "description": [
            "DNA-dependent RNA polymerase (RNAP) catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates"
        ],
        "length": 95,
        "sequence": "MGLERDEILSQDLHFNEVFISLWQNRLTRYEIARVISARALQLAMGAPALIDINNLSSTDVISIAEEEFRRGVLPITIRRRLPNGKIILLSLRKS",
        "proteome": null,
        "gene": "rpo6",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003899",
                "name": "DNA-directed RNA polymerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006351",
                "name": "DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e86b40bc3674d898b799b1be30e5ef4e4a4b7a40",
        "counters": {
            "domain_architectures": 27502,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "ncbifam": 3,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 27502
        }
    }
}