GET /api/protein/UniProt/D0FZI0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D0FZI0",
"id": "D0FZI0_RHIZD",
"source_organism": {
"taxId": "90259",
"scientificName": "Rhizopus microsporus var. rhizopodiformis",
"fullName": "Rhizopus microsporus var. rhizopodiformis"
},
"name": "Actin",
"description": [
"Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells"
],
"length": 267,
"sequence": "HTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDMAGRDLTDYLMRILAERGHAFTTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSALEKSYELPDGQVITVGNERFRAPEALFQPALLGHESVGIHETTYNSIMKCDVDIRKDLYSNIVMSGGTTMYPGIADRMQKEITALAPSSMKIKIVAPPERKYSVWIGGSILASLSTFQQ",
"proteome": null,
"gene": "act-1",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7c3fd5f9f93389082cb00e4f32e34df39e168dec",
"counters": {
"domain_architectures": 86462,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"smart": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"prints": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 86462
}
}
}