GET /api/protein/UniProt/C9ZHT8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C9ZHT8",
"id": "C9ZHT8_TRYB9",
"source_organism": {
"taxId": "679716",
"scientificName": "Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972)",
"fullName": "Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972)"
},
"name": "Histone-lysine N-methyltransferase, H3 lysine-79 specific",
"description": [
"Histone methyltransferase that specifically trimethylates histone H3 to form H3K79me3. This methylation is required for telomere silencing and for the pachytene checkpoint during the meiotic cell cycle by allowing the recruitment of RAD9 to double strand breaks. Nucleosomes are preferred as substrate compared to free histone"
],
"length": 275,
"sequence": "MDARVHRSKRGCGRVLKRSRASSPEVVAEVGTGRPGDPFVLPLRSSPNGSGCHHCPEHSCDCLYVSKELERCYLSLQVSRQVTCKGRRELCAKSVLPPFVARLLRVANVTADDTFYDLGCGNGSVLFHVALATGASCVGVEINEHNAKVAKEAWTHLRPVFEKRRGRKLDVSIVCGDFCKVLKQDNYFSSSCVVWIANLLMPRFVNHYLSERLRSLPIGSRVLCMEDLYPHSRSVAAARDPDAFEKFEMVDYRWQEDSVEWSPASGPFYLYIKRS",
"proteome": null,
"gene": "TbgDal_I40",
"go_terms": [
{
"identifier": "GO:0031151",
"name": "histone H3K79 methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051726",
"name": "regulation of cell cycle",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "072eceed644c5f2af6e249450b7b8920122060a0",
"counters": {
"domain_architectures": 6612,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 6612
}
}
}