General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C9L455",
        "id": "C9L455_BLAHA",
        "source_organism": {
            "taxId": "537007",
            "scientificName": "Blautia hansenii DSM 20583",
            "fullName": "Blautia hansenii DSM 20583"
        },
        "name": "V-type ATP synthase subunit D",
        "description": [
            "Produces ATP from ADP in the presence of a proton gradient across the membrane"
        ],
        "length": 205,
        "sequence": "MDPNTFPTKGNLILAKNSLALSKQGFDLMDKKRNILIRELMDLIEQAKDIQSQIDVTFRTAYAALQKANMEIGISYVQEISRTVPVENSISIKTRSVMGTEIPLVRSEPSSDEPTYSYYGTKASLDEAHAAFEKVKDLTIRLSMVENSAYRLAVNIKKTQKRANALKNITIPKYEALTKSISNALEEKEREEFTRLKVIKRMQGN",
        "proteome": "UP000003755",
        "gene": "atpD",
        "go_terms": [
            {
                "identifier": "GO:0046961",
                "name": "proton-transporting ATPase activity, rotational mechanism",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "79dd410c1f1a6b9c5b7ba91f90d1ab7ed373231c",
        "counters": {
            "domain_architectures": 9746,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9746
        }
    }
}