GET /api/protein/UniProt/C8Z2L2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C8Z2L2",
        "id": "C8Z2L2_THIPF",
        "source_organism": {
            "taxId": "1057",
            "scientificName": "Thiococcus pfennigii",
            "fullName": "Thiococcus pfennigii"
        },
        "name": "Reaction center protein M chain",
        "description": [
            "The reaction center is a membrane-bound complex that mediates the initial photochemical event in the electron transfer process of photosynthesis"
        ],
        "length": 243,
        "sequence": "MPQYFNIFTRVQVRAPAYDGVPLPKGRLPRIGKGVFPSYWLGKLGDTQIGPIYLGFWGIMSLMSGFLAFMIVGIGMLASVSWNPIHFFKFFPWLALEPPPPHYGLHIPPLWDGGMWLIAGFFFTLAFLLWWVRVYVRARDLGMGTHVAWGFAAAIWFFLNLGFFRPILMGSWSEGVPMGWFPHLDWLTGLSLAYGNFYYNPFHMLGIGFMYGSALLWAMHGGTILAVSRFGGDREIDQIVDRG",
        "proteome": null,
        "gene": "pufM",
        "go_terms": [
            {
                "identifier": "GO:0009772",
                "name": "photosynthetic electron transport in photosystem II",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019684",
                "name": "photosynthesis, light reaction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030077",
                "name": "plasma membrane light-harvesting complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "73c30af4df54cc5ea0296573b55812fd28876e62",
        "counters": {
            "domain_architectures": 46410,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 1,
                "pfam": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 46410
        }
    }
}