GET /api/protein/UniProt/C8Z2L2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C8Z2L2",
"id": "C8Z2L2_THIPF",
"source_organism": {
"taxId": "1057",
"scientificName": "Thiococcus pfennigii",
"fullName": "Thiococcus pfennigii"
},
"name": "Reaction center protein M chain",
"description": [
"The reaction center is a membrane-bound complex that mediates the initial photochemical event in the electron transfer process of photosynthesis"
],
"length": 243,
"sequence": "MPQYFNIFTRVQVRAPAYDGVPLPKGRLPRIGKGVFPSYWLGKLGDTQIGPIYLGFWGIMSLMSGFLAFMIVGIGMLASVSWNPIHFFKFFPWLALEPPPPHYGLHIPPLWDGGMWLIAGFFFTLAFLLWWVRVYVRARDLGMGTHVAWGFAAAIWFFLNLGFFRPILMGSWSEGVPMGWFPHLDWLTGLSLAYGNFYYNPFHMLGIGFMYGSALLWAMHGGTILAVSRFGGDREIDQIVDRG",
"proteome": null,
"gene": "pufM",
"go_terms": [
{
"identifier": "GO:0009772",
"name": "photosynthetic electron transport in photosystem II",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0019684",
"name": "photosynthesis, light reaction",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030077",
"name": "plasma membrane light-harvesting complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "73c30af4df54cc5ea0296573b55812fd28876e62",
"counters": {
"domain_architectures": 46410,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"ncbifam": 1,
"pfam": 1,
"prosite": 1,
"prints": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 46410
}
}
}