GET /api/protein/UniProt/C8WIS8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C8WIS8",
        "id": "C8WIS8_EGGLE",
        "source_organism": {
            "taxId": "479437",
            "scientificName": "Eggerthella lenta (strain ATCC 25559 / DSM 2243 / CCUG 17323 / JCM 9979 / KCTC 3265 / NCTC 11813 / VPI 0255 / 1899 B)",
            "fullName": "Eggerthella lenta (strain ATCC 25559 / DSM 2243 / CCUG 17323 / JCM 9979 / KCTC 3265 / NCTC 11813 / VPI 0255 / 1899 B)"
        },
        "name": "Ribosomal silencing factor RsfS",
        "description": [
            "Functions as a ribosomal silencing factor. Interacts with ribosomal protein uL14 (rplN), blocking formation of intersubunit bridge B8. Prevents association of the 30S and 50S ribosomal subunits and the formation of functional ribosomes, thus repressing translation"
        ],
        "length": 142,
        "sequence": "MSTTTTEKTSRECALIAACAADEKKATDIMVQEVRDLIGVTDYFVIATASNNRQVEAIIDEIEDAVRTKAQMKPLHREGTQDGTWSLLDYGSFVVHVFQPETREYYRLEALWNDAPVIDLAAEAGLTDIEYSDRIAKMLGKE",
        "proteome": "UP000001377",
        "gene": "rsfS",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d48e6f35bd449e7c5e049b7acf80a935592d4454",
        "counters": {
            "domain_architectures": 26485,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 26485
        }
    }
}