General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 107.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C8CSA2",
        "id": "C8CSA2_PINMO",
        "source_organism": {
            "taxId": "3345",
            "scientificName": "Pinus monticola",
            "fullName": "Pinus monticola (Western white pine)"
        },
        "name": "Light-independent protochlorophyllide reductase subunit B",
        "description": [
            "Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The NB-protein (ChlN-ChlB) is the catalytic component of the complex"
        ],
        "length": 510,
        "sequence": "MKLAHWMYAGPAHIGTLRVASSFKNVHAIMHAPLGDDYFNVMRSMLERERNFTPATASIVDRHVLARGSRKRVVDNILRKDKEESPDLIILTPTCTSSILQEDLKNFVDRASIISDCNVIFADVDHYQVNEIQAADRTLEQVVRYYLDKSHTLDQFVTDAPSVNIIGILTLGFHNRHDCRELRRLLKDLDIRINQIIPEGGSVEDPKNLPKARFNLIPYREVGLMTAMYLNKEFGMPYVSTTPMGAVDMAECIRQIKKSLDILAAPILSSKRVDYESYIDGQTRFVSQAAWFSRSIDCQNFTGKETVVFGDATHAASITKILAREMGIRVSCTGTYCKHDAEWFKEQIKDFCDEMIITDDHAEVGDIIARVEPSAIFGTQMERHIGKRLEIPCGVISAPAHIXNFSLGYRPFLGYEGTNQIADLVYXSFALGMEDHLLEIFCGHDTKEIMTKSLSTDISPIWDPESRQELGKIPRFVRDEVKINTEKFARRKGLLNVTVEVMHAAKEALS",
        "proteome": null,
        "gene": "chlB",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016730",
                "name": "oxidoreductase activity, acting on iron-sulfur proteins as donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046148",
                "name": "pigment biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015995",
                "name": "chlorophyll biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019685",
                "name": "photosynthesis, dark reaction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015979",
                "name": "photosynthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "4403254cae0e04c060732d03f44753ac1c5ab357",
        "counters": {
            "domain_architectures": 2704,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "cdd": 1,
                "ssf": 1,
                "pfam": 2,
                "pirsf": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2704
        }
    }
}