General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C7NB67",
        "id": "PAGL_LEPBD",
        "source_organism": {
            "taxId": "523794",
            "scientificName": "Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b)",
            "fullName": "Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b)"
        },
        "name": "6-phospho-alpha-glucosidase",
        "description": [
            "In vitro, readily hydrolyzes p-nitrophenyl-alpha-D-glucopyranoside 6-phosphate (pNPalphaG6P), a chromogenic analog of the phosphorylated isomers of sucrose. In vivo, is probably involved in the degradation of the 6-phosphate derivatives of the sucrose isomers trehalulose, turanose, maltulose and palatinose, catalyzing their hydrolysis into glucose 6-phosphate (G6P) and fructose, which allows the bacterium to use these sugars as energy sources for growth. Is not able to hydrolyze the C2 or C4 chromogenic stereomers (i.e. pNPalpha-mannopyranoside-6P and pNPalpha-galactopyranoside-6P, respectively)"
        ],
        "length": 440,
        "sequence": "MKKFSIVVAGGGSTFTPGIVLMLLENLDKFPIRQIKFYDNDAQRQEVIAKACDIIIKEKAPDINFVYTTDPETAFTDIDFVMAHIRVGKYAMREKDEKIPLRHGVLGQETCGPGGISYGMRSIGGVIELVDYMEKYSPNAWMLNYSNPAAIVAEATRRLRPNSKILNICDMPIGIEIRMAEMLGLKSRKDMVIRYFGLNHFGWWTDIRDKKGNDLMPALREKVAKIGYNVEIEGENTEASWNDTFTKARDVFAIDPTTMPNTYLKYYFFPDYVVEHSNPNHTRANEVMEGREKFVFGECRAIAEKGTAKDSKLHVDDHASYIVDLARAIAYDTKERMLLIVENDGAISNFDPTAMVEVPCIVGSNGPEKIVQGKIPQFQKGLMEQQVSVEKLTVEAWMEGSYQKLWQAITLSRTVPSASVAKAILDDLIEANKDFWPVLK",
        "proteome": "UP000001910",
        "gene": "pagL",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016616",
                "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004553",
                "name": "hydrolase activity, hydrolyzing O-glycosyl compounds",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "494a0d6bbdc3a3b5d1f080cdd780dea9b5a252e3",
        "counters": {
            "domain_architectures": 15595,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15595
        }
    }
}