GET /api/protein/UniProt/C7C8E1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C7C8E1",
"id": "C7C8E1_METED",
"source_organism": {
"taxId": "661410",
"scientificName": "Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)",
"fullName": "Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)"
},
"name": "2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase",
"description": [
"Catalyzes the transfer of pyrophosphate from adenosine triphosphate (ATP) to 6-hydroxymethyl-7,8-dihydropterin, an enzymatic step in folate biosynthesis pathway"
],
"length": 158,
"sequence": "MTRAYLGLGSNIGDKAAMLAGAVEHLAATPGIRVVARSADYRTPPWGDTDQDWFLNAAVAIDTELTPHGLLEVCLSIEAALGRVRERRWGPRVIDIDVLAYEGAQVSDERLVLPHRFVRERAFVLVPLAEIAPDLVIGGETVTEALAKLDRSGIERVE",
"proteome": null,
"gene": "folK",
"go_terms": [
{
"identifier": "GO:0003848",
"name": "2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009396",
"name": "folic acid-containing compound biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6bfebcf35cc4d3d49ede3582e809c6036275c15a",
"counters": {
"domain_architectures": 24343,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 24343
}
}
}