General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C6T7A5",
        "id": "C6T7A5_SOYBN",
        "source_organism": {
            "taxId": "3847",
            "scientificName": "Glycine max",
            "fullName": "Glycine max (Soybean)"
        },
        "name": "Replication protein A C-terminal domain-containing protein",
        "description": [
            "Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication. The activity of RPA is mediated by single-stranded DNA binding and protein interactions. Required fo cell division in meristems. Involved in the maintenance of transcriptional epigenetic gene silencing (TGS) at specific loci (including some transposons) by regulating histone H3 acetylation, 'Lys-4' and 'Lys-9' methylation"
        ],
        "length": 292,
        "sequence": "MTNTSNSLSFSLSRVSKMFSGSQFDTTTAFSGGGFTSSQPSTLNDSSPAPSNSRETPGLVPVTVKQISEASQSGDEKSNFVINGVDLNNVTLVGMMFEKVERNTDVSFVLDDGTGRIKCRRWINEAFDTKEMEAVMNDMYVRVYGHLKSFQGVKQLVAFSVRPVTNFDEIPFHFIDCIHNHLRSKIKVEGITSANPSSGSSLETPVKSAPNRSQASNPVCAQRSVDGLKGIDKLVMDYLEQHSDRSDGRGIHVDELSRELKLPIEKIKLSLKTLADDGEIYSTIDDDHYKKA",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006260",
                "name": "DNA replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006310",
                "name": "DNA recombination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f7fa4d85cdf6f65b9c30f6167717a05910c58d2c",
        "counters": {
            "domain_architectures": 1830,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 1,
                "pfam": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1830
        }
    }
}