General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C6S3Z0",
        "id": "C6S3Z0_DIPCM",
        "source_organism": {
            "taxId": "34168",
            "scientificName": "Diphasiastrum complanatum",
            "fullName": "Diphasiastrum complanatum (Issler's clubmoss)"
        },
        "name": "Cytochrome b6-f complex subunit 6",
        "description": [
            "Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetL is important for photoautotrophic growth as well as for electron transfer efficiency and stability of the cytochrome b6-f complex"
        ],
        "length": 31,
        "sequence": "MSTILSYSGFLLAAPISAPVLFIGLNKIKLI",
        "proteome": null,
        "gene": "petL",
        "go_terms": [
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009512",
                "name": "cytochrome b6f complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b1ec384e42f4ea94f941cc04be64ce61cc8ad746",
        "counters": {
            "domain_architectures": 13116,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 13116
        }
    }
}