GET /api/protein/UniProt/C6KT68/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C6KT68",
        "id": "FENR_PLAF7",
        "source_organism": {
            "taxId": "36329",
            "scientificName": "Plasmodium falciparum (isolate 3D7)",
            "fullName": "Plasmodium falciparum (isolate 3D7)"
        },
        "name": "Ferredoxin--NADP reductase, apicoplast",
        "description": [
            "May play a role in the terminal step of the DOXP/MEP pathway for isoprenoid precursor biosynthesis"
        ],
        "length": 371,
        "sequence": "MKIRFVFILSVLISGVCCISKNVSRRVANRMTAHSRFLFVHDKYKRNKNFKLKNNKEENNFINLYTVKNPLKCKIVDKINLVRPNSPNEVYHLEINHNGLFKYLEGHTCGIIPYYNELDNNPNNQINKDHNIINTTNHTNHNNIALSHIKKQRCARLYSISSSNNMENLSVAIKIHKYEQTENAPNITNYGYCSGFIKNLKINDDIYLTGAHGYFNLPNDAIQKNTNFIFIATGTGISPYISFLKKLFAYDKNNLYNRNSNYTGYITIYYGVYNEDSILYLNELEYFQKMYPNNINIHYVFSYKQNSDATSFYVQDEIYKRKTEFLNLFNNYKCELYICGHKSIRYKVMDILKSHDQFDEKKKKRVHVEVY",
        "proteome": "UP000001450",
        "gene": "FNR",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7b77724a6badd7c3c64362bc95256b98bcd62609",
        "counters": {
            "domain_architectures": 11203,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 5,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "cdd": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11203
        }
    }
}