General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C6HRN2",
        "id": "GATB_AJECH",
        "source_organism": {
            "taxId": "544712",
            "scientificName": "Ajellomyces capsulatus (strain H143)",
            "fullName": "Ajellomyces capsulatus (strain H143) (Darling's disease fungus)"
        },
        "name": "Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial",
        "description": [
            "Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln)"
        ],
        "length": 574,
        "sequence": "MIRQFVSHRGIPCYRLAVRRVELTEPFHHPSPWPLGRKNWSTSDEAKSKRAAMRKGGAPPPEHEDWELTVGIEIHAQLDTDAKLFSSASAALDDVPNSNIALFDIALPGSQPLFQPSTLIPAIRAAIALNCDVQRVSRFDRKHYFYQDQPAGYQITQYYEPYAKNGSIWLGAHDGIAKEDGEGVQIGIKQIQMEQDTAKSQELPSSTYLLDFNRVSRPLIEIITLPQIHSATTAAACVRKIQAILQSVGAVTTGMEMGGLRADVNVSVRKRSEAAGDHQYDGVAGLGQRTEIKNLSSFKAVEYAIIAERDRQIAVLKAGGTIQGETRGWTLGSTETRKLRGKEGEVDYRYMPDPDLGPVIIGDDVISDLRRNIPGLPDELLQMLVQDPKYGLSTVDAKTLIELDDGQRLEYYQDAVEILTTLQPDLSADFSAGKVVGNWVLHELGGLLTKSSAHWDSQRVPAQSLAEIINLLSRKNITSSSAKSLLAMAFDGDKRSISQIVEDKNLLFQSLSRHEYLALAEEVMRQNPKMVSEIREKAQLGKMGWLVGQIKRIGDPNRVEAQKAEEILRELILK",
        "proteome": null,
        "gene": "HCDG_08617",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016874",
                "name": "ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016884",
                "name": "carbon-nitrogen ligase activity, with glutamine as amido-N-donor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "320ed30c9beaffdacfe991878650c6fe77022603",
        "counters": {
            "domain_architectures": 25767,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "pfam": 2,
                "smart": 1,
                "panther": 1,
                "ncbifam": 2,
                "hamap": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 25767
        }
    }
}