General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C5MI71",
        "id": "C5MI71_CANTT",
        "source_organism": {
            "taxId": "294747",
            "scientificName": "Candida tropicalis (strain ATCC MYA-3404 / T1)",
            "fullName": "Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast)"
        },
        "name": "Ribosome assembly factor mrt4",
        "description": [
            "Component of the ribosome assembly machinery. Nuclear paralog of the ribosomal protein P0, it binds pre-60S subunits at an early stage of assembly in the nucleolus, and is replaced by P0 in cytoplasmic pre-60S subunits and mature 80S ribosomes"
        ],
        "length": 229,
        "sequence": "MPRSKRSKLVTLAQTDKKGKENKTRLFDDVRSALDTYKYVWVLQFDDIRTPVLQDIRNDWNESKLILGKRKVLQKALGESIEEEYKDNLNQLTKILEGLPGLLFTNEDPETVDAYFKAYSKQDYSRAKSKAPIDFIIPQGIVYSRGGQIPIEEDVPMSHSLEETLRNKLRVPTKIKAGKIVLDEPYVVCNEGEVLDVRQAMLLKQFGVAASEFKVPVLGYYHDGEVHKY",
        "proteome": "UP000002037",
        "gene": "CTRG_05764",
        "go_terms": [
            {
                "identifier": "GO:0000027",
                "name": "ribosomal large subunit assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c6aebf5278acac33a60101385747d8081782d964",
        "counters": {
            "domain_architectures": 5943,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5943
        }
    }
}