HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C5D3R9",
"id": "RL23_GEOSW",
"source_organism": {
"taxId": "471223",
"scientificName": "Geobacillus sp. (strain WCH70)",
"fullName": "Geobacillus sp. (strain WCH70)"
},
"name": "Large ribosomal subunit protein uL23",
"description": [
"One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome"
],
"length": 95,
"sequence": "MKDPRDIIKRPIITENTMNLTAQKKYTFEVDVKANKTEVKEAVEKIFGVKVEKVNIMNYKGKFKRVGRYSGYTNRRRKAIVTLTPDSKDIELFEV",
"proteome": null,
"gene": "rplW",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0019843",
"name": "rRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "118b0ee2cd3e298b8d4868fd2abf4aa4160aa12b",
"counters": {
"domain_architectures": 42768,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"ncbifam": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 42768
}
}
}