General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C5BG44",
        "id": "C5BG44_EDWI9",
        "source_organism": {
            "taxId": "634503",
            "scientificName": "Edwardsiella ictaluri (strain 93-146)",
            "fullName": "Edwardsiella ictaluri (strain 93-146)"
        },
        "name": "Ribosomal RNA large subunit methyltransferase F",
        "description": [
            "Specifically methylates the adenine in position 1618 of 23S rRNA"
        ],
        "length": 309,
        "sequence": "MNHKPVTPSDRHQKAGLHPRNRHHGRYDMAVLCRISPALGAFVRVTPGGGESIDFADPQAVRALNRALLAQDYGIAHWDIPAQFLCPPIPGRADYLHYLADLLASTRSDGAIPRGAQTCVLDIGTGANCIYPLLGQAEYGWRFTGSDISAQALAAAAAIIRANPALGTRIRLRRQRQPQAIFQGIIKAGEYYAATMCNPPFHRSAAEAAAGSQRKLTNLGLRPPQAARLNFGGRADELWCDGGEQAFILRMIAESRAFATQVGWFTSLVSRRETLPALRRALRAIPVQEMREVTMAQGQKVSRFIAWRF",
        "proteome": null,
        "gene": "rlmF",
        "go_terms": [
            {
                "identifier": "GO:0008988",
                "name": "rRNA (adenine-N6-)-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006364",
                "name": "rRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f9bd581a3a0b0da81ad992000350dc2817d5cedb",
        "counters": {
            "domain_architectures": 8629,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pirsf": 1,
                "pfam": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 8629
        }
    }
}