GET /api/protein/UniProt/C5A033/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C5A033",
"id": "ENGB_ECOBW",
"source_organism": {
"taxId": "595496",
"scientificName": "Escherichia coli (strain K12 / MC4100 / BW2952)",
"fullName": "Escherichia coli (strain K12 / MC4100 / BW2952)"
},
"name": "Probable GTP-binding protein EngB",
"description": [
"Necessary for normal cell division and for the maintenance of normal septation"
],
"length": 210,
"sequence": "MTNLNYQQTHFVMSAPDIRHLPSDTGIEVAFAGRSNAGKSSALNTLTNQKSLARTSKTPGRTQLINLFEVADGKRLVDLPGYGYAEVPEEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLASGARKAQLNMVREAVLAFNGDVQVETFSSLKKQGVDKLRQKLDTWFSEMQPVEETQDGE",
"proteome": null,
"gene": "engB",
"go_terms": [
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4b93c256160c3eea4f0633720a92f3a06a024d5d",
"counters": {
"domain_architectures": 70445,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 70445
}
}
}