General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C4Z6B0",
        "id": "C4Z6B0_LACE2",
        "source_organism": {
            "taxId": "515620",
            "scientificName": "Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)",
            "fullName": "Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)"
        },
        "name": "Glutamate--tRNA ligase",
        "description": [
            "Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu)"
        ],
        "length": 552,
        "sequence": "MNEQDCKKLAELLFPDVDKTPDYYEEKYPYRKLPNKAEVTRLGPSPTGFIHLGNLYSALADERIAHKNGGVFYLRIEDTDAKRTVEGAVDLVINSLRYFDIEFDEGAGFPDSDPVNAYGPYYQTQRVDIYHTFAKELVLKGLAYPCFCTEEELEAVRLQQETDKVLTGYYGKYAVCRDLSLETIEENLKAGKPYVLRLRSQGSPENEITFTDSIKGEIKLPENIHDVVLLKKDGIPTYHFAHAIDDHFMRTTTVVRGGEWLASVPIHYELFHVLGFKMPKYAHTAHLMKFDEETGGKRKLSKRKDPELSLDYYRKDGYHPYTMKVYLLTLLNSNFEEWHEKFPDKDINEFPFSVDKMSVSGALFDKEKLHNICKNELSKLSEDDLYEFLHNWALENEPEMEKVWFADKEKLLAILRLYMGVGAKRRRKDFMYAKQIFELISFFFDGESGERDEFRLVDDEVKAILNDYLAAYDHNDDNSMWFNKLKEIADKNGYASDMKAYKANPENFKGNVSDVAEVVRIAVTGRANTPDLWTIVHIMGEEQMKERISRFL",
        "proteome": "UP000001476",
        "gene": "gltX",
        "go_terms": [
            {
                "identifier": "GO:0004812",
                "name": "aminoacyl-tRNA ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0043039",
                "name": "tRNA aminoacylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000049",
                "name": "tRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000166",
                "name": "nucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004818",
                "name": "glutamate-tRNA ligase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006424",
                "name": "glutamyl-tRNA aminoacylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006418",
                "name": "tRNA aminoacylation for protein translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e10e2c67829782d705a884e78c5d8f92bbd7f4fa",
        "counters": {
            "domain_architectures": 32495,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32495
        }
    }
}