GET /api/protein/UniProt/C4Z4I6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C4Z4I6",
        "id": "C4Z4I6_LACE2",
        "source_organism": {
            "taxId": "515620",
            "scientificName": "Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)",
            "fullName": "Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)"
        },
        "name": "Stage 0 sporulation protein A homolog",
        "description": [
            "May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response to nutritional stress. Spo0A may act in concert with spo0H (a sigma factor) to control the expression of some genes that are critical to the sporulation process"
        ],
        "length": 241,
        "sequence": "MRYRIGICDDEISTCSEIETCIQQRFRNKSDSVEVFVWNSAESFINDVPEKTDLDILFLDIELPEKNGVDVGYYIRESMMNVGMHIIYISSKTSYALDLFDIHPYNFFVKPLSCEKICSEIEKLLQLDRQDKRFFTYIYNKSQYKVLYGNIIYLKSDKHQINIICSDSEKRYVGKLKQELNRLPVYFVMVNQSIVVNIRHIKEFLLNEIVMDNGDYIAISKNYRKSFNMQILDLQMEQDNI",
        "proteome": "UP000001476",
        "gene": "EUBELI_00657",
        "go_terms": [
            {
                "identifier": "GO:0000160",
                "name": "phosphorelay signal transduction system",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000156",
                "name": "phosphorelay response regulator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d88ddc8025a3dba0ebd843f93c84066aef014cfa",
        "counters": {
            "domain_architectures": 52993,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "smart": 2,
                "ssf": 1,
                "profile": 2,
                "pfam": 2,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 52993
        }
    }
}