General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C4WSL9",
        "id": "C4WSL9_ACYPI",
        "source_organism": {
            "taxId": "7029",
            "scientificName": "Acyrthosiphon pisum",
            "fullName": "Acyrthosiphon pisum (Pea aphid)"
        },
        "name": "5-demethoxyubiquinone hydroxylase, mitochondrial",
        "description": [
            "Catalyzes the hydroxylation of 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2) during ubiquinone biosynthesis. Has also a structural role in the COQ enzyme complex, stabilizing other COQ polypeptides. Involved in lifespan determination in a ubiquinone-independent manner"
        ],
        "length": 193,
        "sequence": "MKMVVQKNTFSRIIFQRGLHGANKKLDSLIRVNHAGELGADRIYAGQMAVLGNSSVGPKIKEMWEQEKVHRHKFEQLIIQNRVRPSLLFPLWHCAGYVLGAGTALMGPKAAMACTVAVETVIVEHYNDQLRDLMNDPDSDKELLETIKKFRDEEQEHHDCGIDHGAEQAPFYDALTKVIKTGCKVAIEVAKRV",
        "proteome": "UP000007819",
        "gene": "ACYPI003157",
        "go_terms": [
            {
                "identifier": "GO:0004497",
                "name": "monooxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006744",
                "name": "ubiquinone biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9c8270a77e555cfef2f2654ca1aae80eecbff10b",
        "counters": {
            "domain_architectures": 8602,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8602
        }
    }
}