General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C4R613",
        "id": "DEGS_KOMPG",
        "source_organism": {
            "taxId": "644223",
            "scientificName": "Komagataella phaffii (strain GS115 / ATCC 20864)",
            "fullName": "Komagataella phaffii (strain GS115 / ATCC 20864) (Yeast)"
        },
        "name": "Sphingolipid delta(4)-desaturase",
        "description": [
            "Delta(4)-fatty-acid desaturase which introduces a double bond at the 4-position in the long-chain base (LCB) of ceramides. Required for the formation of the monounsaturated sphingoid base (E)-sphing-4-enine during glucosylceramide (GluCer) biosynthesis"
        ],
        "length": 360,
        "sequence": "MITHRSNNVQYEVTPPSVEEDLGPQFEFYWTRQKDPHSIRRKLILAKHPEVAKLCGPEWRTKYIASAVVLLQLSIAYALKNTPVLSFKFLALAYVVGATANQNCFLCIHELSHNLAFRKPLHNKLFAIWVNLPIGVPYSASFQPYHQLHHKFLGDEVLDTDLPTPLEATVLSSLLGKAFFATFQIFFYALRPMMVTSIDMTFIHLLNVLVCLVSDFILIKFGSANSLWYLILSSFFAGSLHPTAGHFIAEHYLLDPPKHYTQFQDVPPLETYSYYGMLNLFTWNVGYHNEHHDFPFIAWSKLPLLRTIAHDFYQPLPKHTSWVRVIVDFIFDENVLMYNRVKRETAKDKSVDSKTTKTQS",
        "proteome": "UP000000314",
        "gene": "PAS_chr3_0939",
        "go_terms": [
            {
                "identifier": "GO:0042284",
                "name": "sphingolipid delta-4 desaturase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030148",
                "name": "sphingolipid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0006629",
                "name": "lipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5b60997cbc13ae1895369f6c97685846abc35b73",
        "counters": {
            "domain_architectures": 4874,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "pfam": 2,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4874
        }
    }
}