GET /api/protein/UniProt/C4KJ91/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C4KJ91",
        "id": "RS4_SACI6",
        "source_organism": {
            "taxId": "426118",
            "scientificName": "Saccharolobus islandicus (strain M.16.4 / Kamchatka #3)",
            "fullName": "Saccharolobus islandicus (strain M.16.4 / Kamchatka #3)"
        },
        "name": "Small ribosomal subunit protein uS4",
        "description": [
            "One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the body of the 30S subunit",
            "With S5 and S12 plays an important role in translational accuracy"
        ],
        "length": 181,
        "sequence": "MGDPKKSRKKWESPGHPWIKERIGYEQELLGKYGLRNKREIWIAQSIIRKFRHQARSLLALPPAERAVREKQLVGKLLKMGLLKRETATVDDILSLTEQDLLERRLQTIVYKKGLANTTYQARQLIIHGHIAVNGKRVTSPGYIVNVDEENLIDYYVTSSFKSRPPVMAQQEGGEAGVKQA",
        "proteome": null,
        "gene": "rps4",
        "go_terms": [
            {
                "identifier": "GO:0019843",
                "name": "rRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015935",
                "name": "small ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d40e1d453ea50e2d0fcfcaee483cefa3c3915568",
        "counters": {
            "domain_architectures": 58603,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 2,
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 2,
                "profile": 1,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 58603
        }
    }
}