GET /api/protein/UniProt/C4K436/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C4K436",
        "id": "C4K436_HAMD5",
        "source_organism": {
            "taxId": "572265",
            "scientificName": "Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)",
            "fullName": "Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)"
        },
        "name": "Lipid-A-disaccharide synthase",
        "description": [
            "Condensation of UDP-2,3-diacylglucosamine and 2,3-diacylglucosamine-1-phosphate to form lipid A disaccharide, a precursor of lipid A, a phosphorylated glycolipid that anchors the lipopolysaccharide to the outer membrane of the cell"
        ],
        "length": 381,
        "sequence": "MQNRSFTIGLVAGEASGDILAAGLIRALKAQFPNVSFVGVAGPLMQAEGCEVWYEMEKLSVMGILEVLHHLPRLIHIRRDLTRRFMMLRPDIFIGIDAPDFNIRLEKKLKQKGIRTLHYVSPSVWAWRQNRLFSLAQATDMVLALFPFEKQFYDRFNIPCYFVGHMMADEIPLIPDKSAARMALGIDQNSLCLALLPGSRQAELALLGADFIRTAMLLHQQLPQLKVLVPLSNNQRRKQFERIQAKIAPHFSMHLFNGQARLVLEASNAALLASGTVTLESMLAKCPMVVSYRLKYLTYWIAKLLVKTPYFSLPNLLVGERLVPELLQKNCDPQKLSNELLPLLKGGKNVQMLKERFLVLHQSLRCGANQKAAQAVLALIK",
        "proteome": "UP000002334",
        "gene": "lpxB",
        "go_terms": [
            {
                "identifier": "GO:0008915",
                "name": "lipid-A-disaccharide synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009245",
                "name": "lipid A biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1907e39d925d0c94cd3918ff1485d96b42f6a0f0",
        "counters": {
            "domain_architectures": 15339,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "ncbifam": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15339
        }
    }
}