General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C4IB41",
        "id": "C4IB41_CLOBU",
        "source_organism": {
            "taxId": "632245",
            "scientificName": "Clostridium butyricum E4 str. BoNT E BL5262",
            "fullName": "Clostridium butyricum E4 str. BoNT E BL5262"
        },
        "name": "dihydrouracil dehydrogenase (NAD(+))",
        "description": [
            "Involved in pyrimidine base degradation. Catalyzes physiologically the reduction of uracil to 5,6-dihydrouracil (DHU) by using NADH as a specific cosubstrate. It also catalyzes the reverse reaction and the reduction of thymine to 5,6-dihydrothymine (DHT)"
        ],
        "length": 362,
        "sequence": "MNLNTTIGKIKLENPLMPASGPLVGDKDKMSALNEFGVGAMVTKTISSKKAEVVRPCIYGGKNFIMNAELWSEYAPEVWIDEFLPSIKKELKDKPLIISVGYTKEDMEFLIPKLDVFADAFEISTHYVGKDLSNIKETLKTIRRFTQKPVFMKMSPHIPDPIGFAKMVIENKGSGIVAINSLGPTMNIDIDKRSVLIGNKEGEVWTSGPAIKPMALALIHKIKKAVPECEIIGVGGISSADDIIEFLLAGASAVQMLSAAMLKGKDLYEKLIEELPKALKKHGFNSVEEVINEKLSIGQVKYEPEYPLINKDKCTNCRLCEKACPYFAITSIDNQIKIDTKNCFGCGLCESRCPSKAIYNVF",
        "proteome": "UP000003081",
        "gene": "CLP_0393",
        "go_terms": [
            {
                "identifier": "GO:0016627",
                "name": "oxidoreductase activity, acting on the CH-CH group of donors",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9b394982993580a5a96612cb117e0a00c5ac2a94",
        "counters": {
            "domain_architectures": 150,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "pfam": 2,
                "cathgene3d": 3,
                "profile": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 150
        }
    }
}