GET /api/protein/UniProt/C3K0N3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C3K0N3",
"id": "ACP_PSEFS",
"source_organism": {
"taxId": "216595",
"scientificName": "Pseudomonas fluorescens (strain SBW25)",
"fullName": "Pseudomonas fluorescens (strain SBW25)"
},
"name": "Acyl carrier protein",
"description": [
"Carrier of the growing fatty acid chain in fatty acid biosynthesis"
],
"length": 78,
"sequence": "MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEAEKITTVQAAIDYVTSHQA",
"proteome": null,
"gene": "acpP",
"go_terms": [
{
"identifier": "GO:0031177",
"name": "phosphopantetheine binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006633",
"name": "fatty acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3c9e8d520e54d5947b224319c71493893473a1da",
"counters": {
"domain_architectures": 82947,
"entries": 18,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"ncbifam": 5,
"panther": 1,
"hamap": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 82947
}
}
}