GET /api/protein/UniProt/C1MZJ9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C1MZJ9",
"id": "C1MZJ9_MICPC",
"source_organism": {
"taxId": "564608",
"scientificName": "Micromonas pusilla (strain CCMP1545)",
"fullName": "Micromonas pusilla (strain CCMP1545) (Picoplanktonic green alga)"
},
"name": "HECT-type E3 ubiquitin transferase",
"description": [
"Probable E3 ubiquitin-protein ligase which mediates ubiquitination and subsequent proteasomal degradation of target proteins"
],
"length": 397,
"sequence": "MEAFGFTPEHHIQVTRGRVFADALDALGPAALKHENRRWRDDHVGERPPGSLKGVVRVNFVNEHGVEEAGVDGGGLFKDFLSALIEEAFDPKVGLFVETPDRTLYPNPASWKHAGADHLRKLEFLGAMLGKAVYEGILVDLPLAGFFLAKLRDGRPPELNDLATLDPELYHHLLSLKRLPARDVEDLFLHFTASDPDGVGGDVDLIPGGSEIRVDGENRGRYVHLLAHHLMHARIRRQSKAFVDGFRGLIEPSWLRVFAPAELRLLISGAGGKIDIDDLARSATYSGGYTADHPTVTALWDALRECREEDQRAFLKFVTACPNTPLLGFSQLMPPFCVHRSGMSSGSRASEDTADLARLPTAATCMNLLKLPPYKTKDAVKEKLLYAVTSGSGFDLS",
"proteome": "UP000001876",
"gene": "MICPUCDRAFT_19835",
"go_terms": [
{
"identifier": "GO:0004842",
"name": "ubiquitin-protein transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0061630",
"name": "ubiquitin protein ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000209",
"name": "protein polyubiquitination",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5e515aed9026e907fb22cbca430c4930ce73733c",
"counters": {
"domain_architectures": 27219,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"smart": 1,
"ssf": 1,
"cathgene3d": 3,
"profile": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 27219
}
}
}