GET /api/protein/UniProt/C1MYV2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C1MYV2",
"id": "C1MYV2_MICPC",
"source_organism": {
"taxId": "564608",
"scientificName": "Micromonas pusilla (strain CCMP1545)",
"fullName": "Micromonas pusilla (strain CCMP1545) (Picoplanktonic green alga)"
},
"name": "Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic",
"description": [
"Catalytic subunit of the ferredoxin-thioredoxin reductase (FTR), which catalyzes the two-electron reduction of thioredoxins by the electrons provided by reduced ferredoxin"
],
"length": 165,
"sequence": "MQSTLARPASLARSSATLSSSATHRGVGLAVTSPAPRLARRGANRGVVKVRAEASEKNLEVMRKFSEQYAKGSGTYFCMDKSVTAVVIQGLAEHKDTLGSPLCPCRHYDDKEAEVKSGFWNCPCVPMRERKECHCMLFLTEDNDFVGDEQTITIDEVVELSEGMM",
"proteome": "UP000001876",
"gene": "MICPUCDRAFT_63197",
"go_terms": [
{
"identifier": "GO:0016730",
"name": "oxidoreductase activity, acting on iron-sulfur proteins as donors",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b35b7a4fe9300bb12241aaf99248283c75459e2c",
"counters": {
"domain_architectures": 2006,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2006
}
}
}