GET /api/protein/UniProt/C1G7Y1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C1G7Y1",
        "id": "C1G7Y1_PARBD",
        "source_organism": {
            "taxId": "502780",
            "scientificName": "Paracoccidioides brasiliensis (strain Pb18)",
            "fullName": "Paracoccidioides brasiliensis (strain Pb18)"
        },
        "name": "1,3-beta-glucanosyltransferase",
        "description": [
            "Splits internally a 1,3-beta-glucan molecule and transfers the newly generated reducing end (the donor) to the non-reducing end of another 1,3-beta-glucan molecule (the acceptor) forming a 1,3-beta linkage, resulting in the elongation of 1,3-beta-glucan chains in the cell wall. Involved in cell wall morphogenesis"
        ],
        "length": 442,
        "sequence": "MKAIAASALSAAVLASSALTGEASIIKSRTNKITPVTVKGNAFWNGKERFYLRGVDYQPGWPSNLKDPIAEPRLCKRDIAKFKELGVNTIRVYSVDNSINHDECMEALADAGIYLALDVNTPKYSINRTDPNNSYNAAYLQNVFATVEMFAKYDNTLAFFSGNEVLNDGNSSMAAPYVKAVTRDIHNFLHSRNMRDIPVGYSAADVDTNRVHLAHYMNCGSDDERSDFFAFNDYSWCDPSSFENSSWDKKVQAFTGYGIPLFLSEYGCNRSEHNWNEVTALYSSNVTSVYSGGLVYEYSQEPNSIGLVQIKDGKLTKLPEFDKLKEAFANAKSPSGDGGFNKTGGANPCPKKDGPNWYVGDEALPAMPDGAKIYLLQGAGNGSQTASSGSPGPGSGTNGVKAGQLFALRTQSAAAGLEPPKILSAFLYVPLLLERLRSLAFH",
        "proteome": "UP000001628",
        "gene": "PADG_03286",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9be63055f980b6c6f0d373e34596ce959420a0ce",
        "counters": {
            "domain_architectures": 4786,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4786
        }
    }
}