General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C1FSN3",
        "id": "C1FSN3_CLOBJ",
        "source_organism": {
            "taxId": "536232",
            "scientificName": "Clostridium botulinum (strain Kyoto / Type A2)",
            "fullName": "Clostridium botulinum (strain Kyoto / Type A2)"
        },
        "name": "D-proline reductase, gamma subunit PrdB, selenocysteine-containing",
        "description": null,
        "length": 239,
        "sequence": "MNIVKGLQSEIFVPITPNPVWAPVTMELKDMTVALATAAGVHLKSDKRFNLAGDFTYRLVPGDAKTSDMMVSHGGYDNGDVNKDINAMFPIDRLRELADAGFIKAVAKTHIGFMGGGGNQQKFREETGPEVAKILKEEGVDAVLMTAGUGTCHRSAVIVQRAIEEIGIPTIIIAALPPVVKQSGTPRAVAPRVPMGANAGEPNNVEMQTAIVKETLEQLIKIPSAGKVVPLPYEYIAKV",
        "proteome": null,
        "gene": "prdB",
        "go_terms": [
            {
                "identifier": "GO:0050485",
                "name": "oxidoreductase activity, acting on X-H and Y-H to form an X-Y bond, with a disulfide as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050002",
                "name": "D-proline reductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "2c37f664d8f46e1a9037d16ef73a1ab8ffd90d99",
        "counters": {
            "domain_architectures": 2079,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ncbifam": 2,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2079
        }
    }
}