General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C1F978",
        "id": "C1F978_ACIC5",
        "source_organism": {
            "taxId": "240015",
            "scientificName": "Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)",
            "fullName": "Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)"
        },
        "name": "LexA repressor",
        "description": [
            "Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair"
        ],
        "length": 198,
        "sequence": "MTKRQKEVLDFITGFVQRNGYSPSFEEIARGLNLKSLATVHKHITNLQNKGLLARAHNRSRSLDVLPPRSRGRSVDRLPLMGRIAAGRPVEAAENAESISLGDIIGNREVFALQVHGESMRDEHIVDGDYVLVERTNTARQGEIIVALVRGAETTLKRFYLEGSMVRLQPSNAEMNPIIVPAAQVAIQGRVLGMLRKY",
        "proteome": "UP000002207",
        "gene": "lexA",
        "go_terms": [
            {
                "identifier": "GO:0004252",
                "name": "serine-type endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006508",
                "name": "proteolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009432",
                "name": "SOS response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045892",
                "name": "negative regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "80ebd7e7a187ff1e5bf9b0d007a9803b2e453c54",
        "counters": {
            "domain_architectures": 20379,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 9
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 20379
        }
    }
}