General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C1E4J9",
        "id": "C1E4J9_MICCC",
        "source_organism": {
            "taxId": "296587",
            "scientificName": "Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709)",
            "fullName": "Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) (Picoplanktonic green alga)"
        },
        "name": "Photosystem I reaction center subunit III",
        "description": [
            "Participates in efficiency of electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). This plastocyanin-docking protein contributes to the specific association of plastocyanin to PSI"
        ],
        "length": 237,
        "sequence": "MAAIASLNAVAPAKLSSKMSTGIKAQAKVAAKAPVAVVSCSAEKAATKVAAIAAAAAIAVAAPMVAPEEAFARDVQPYAGLTPCKKNKAFAKREKQEIKALEKRLKKYDPESAPALALKATMDKTSQRFKNYGEAGLLCGADGLPHLIVDGNLEHLGEFAIPGLGFLYVAGWIGYAGRSYVMLNKEKAKPTEGEIIIDVPTALGLMMAAGAWPVKAFFELKNGTLTAPESEITVSPR",
        "proteome": "UP000002009",
        "gene": "PSAF",
        "go_terms": [
            {
                "identifier": "GO:0015979",
                "name": "photosynthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009522",
                "name": "photosystem I",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0009538",
                "name": "photosystem I reaction center",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e4cf84b3d7417afba139e045fd0932c9e4da72ef",
        "counters": {
            "domain_architectures": 1630,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1630
        }
    }
}