General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C0RFS0",
        "id": "AROK_BRUMB",
        "source_organism": {
            "taxId": "546272",
            "scientificName": "Brucella melitensis biotype 2 (strain ATCC 23457)",
            "fullName": "Brucella melitensis biotype 2 (strain ATCC 23457)"
        },
        "name": "Shikimate kinase",
        "description": [
            "Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate"
        ],
        "length": 200,
        "sequence": "MSGTNKQTNLHRQTETIRQLLGSKVVVLVGLMGAGKSTIGRKVANMLNLPFKDADTEIETVSRMTVAELFEAYGEVEFRDLERRVILRLLDDGPMVLATGGGAYMNAETRAAIAEAGISIWINADLDVLMERVSRRQNRPLLRNSDPRGVMQRLMDERYPVYALAELHLMTRDEKKEVIAAELIEVLAAHLEKEQAASAG",
        "proteome": null,
        "gene": "aroK",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "73ffdc8dadfe2f2e23806a5420ad0e38b817d41e",
        "counters": {
            "domain_architectures": 34052,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 1,
                "panther": 1,
                "hamap": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 34052
        }
    }
}