GET /api/protein/UniProt/C0PWY4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C0PWY4",
"id": "C0PWY4_SALPC",
"source_organism": {
"taxId": "476213",
"scientificName": "Salmonella paratyphi C (strain RKS4594)",
"fullName": "Salmonella paratyphi C (strain RKS4594)"
},
"name": "Malonyl-[acyl-carrier protein] O-methyltransferase",
"description": [
"Converts the free carboxyl group of a malonyl-thioester to its methyl ester by transfer of a methyl group from S-adenosyl-L-methionine (SAM). It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway"
],
"length": 251,
"sequence": "MAQVNKQAIAAAFGRAASQYEQHASLQQHSADALLTLLTGRQFASVLDAGCGPGRMSRYWRERGSEVTALDLSLPMLQQARDRQAAHHYLLADIEAIPHDAEVFDLAWSNLAVQWCGDLRDALSELYRVVRPGGVVAFTTLCQGSLPELRQAWQAVDNRAHANSFLPEEAIDHALRGWRAFRHTQAMTLWFEDALSAMRSLKGIGATHLHEGRESDVLTRARLRQIQLAWPQRQGKYPLTYHLFMGVIERD",
"proteome": null,
"gene": "bioC",
"go_terms": [
{
"identifier": "GO:0008757",
"name": "S-adenosylmethionine-dependent methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0010340",
"name": "carboxyl-O-methyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009102",
"name": "biotin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "acfb62ec32a98f53f626420cecc289d2c02361e6",
"counters": {
"domain_architectures": 191063,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 191063
}
}
}