General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C0PWY4",
        "id": "C0PWY4_SALPC",
        "source_organism": {
            "taxId": "476213",
            "scientificName": "Salmonella paratyphi C (strain RKS4594)",
            "fullName": "Salmonella paratyphi C (strain RKS4594)"
        },
        "name": "Malonyl-[acyl-carrier protein] O-methyltransferase",
        "description": [
            "Converts the free carboxyl group of a malonyl-thioester to its methyl ester by transfer of a methyl group from S-adenosyl-L-methionine (SAM). It allows to synthesize pimeloyl-ACP via the fatty acid synthetic pathway"
        ],
        "length": 251,
        "sequence": "MAQVNKQAIAAAFGRAASQYEQHASLQQHSADALLTLLTGRQFASVLDAGCGPGRMSRYWRERGSEVTALDLSLPMLQQARDRQAAHHYLLADIEAIPHDAEVFDLAWSNLAVQWCGDLRDALSELYRVVRPGGVVAFTTLCQGSLPELRQAWQAVDNRAHANSFLPEEAIDHALRGWRAFRHTQAMTLWFEDALSAMRSLKGIGATHLHEGRESDVLTRARLRQIQLAWPQRQGKYPLTYHLFMGVIERD",
        "proteome": null,
        "gene": "bioC",
        "go_terms": [
            {
                "identifier": "GO:0008757",
                "name": "S-adenosylmethionine-dependent methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0010340",
                "name": "carboxyl-O-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009102",
                "name": "biotin biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "acfb62ec32a98f53f626420cecc289d2c02361e6",
        "counters": {
            "domain_architectures": 191063,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 2,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 191063
        }
    }
}