GET /api/protein/UniProt/C0JB13/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C0JB13",
        "id": "A333_LOXLA",
        "source_organism": {
            "taxId": "58217",
            "scientificName": "Loxosceles laeta",
            "fullName": "Loxosceles laeta (South American recluse spider)"
        },
        "name": "Dermonecrotic toxin LlSicTox-alphaIII3iii",
        "description": [
            "Dermonecrotic toxins cleave the phosphodiester linkage between the phosphate and headgroup of certain phospholipids (sphingolipid and lysolipid substrates), forming an alcohol (often choline) and a cyclic phosphate (By similarity). This toxin acts on sphingomyelin (SM) (By similarity). It may also act on ceramide phosphoethanolamine (CPE), lysophosphatidylcholine (LPC) and lysophosphatidylethanolamine (LPE), but not on lysophosphatidylserine (LPS), and lysophosphatidylglycerol (LPG) (By similarity). It acts by transphosphatidylation, releasing exclusively cyclic phosphate products as second products (By similarity). Induces dermonecrosis, hemolysis, increased vascular permeability, edema, inflammatory response, and platelet aggregation (By similarity)"
        ],
        "length": 278,
        "sequence": "WIMGHMVNAVKQIPTFLNDGANAIEADITFKGAVPTYSYHGTPCDFGRVCIRWEYFDVFLQTLRDYTTPGNSKYYEKFILFVLDLKTGSLNNNEVRKAGENVAKGLLKNYWNNGNNGGRAYVVLSLPDIAHYEFIRTFKEVLKAEGHENLLDKVGYDLSGPYLPSLPSLDSVHEAFKKAGVDGHVWLSDGLTNWAPLGDMARLKEIVKRRDSENGFISKVYYWFVDKYSTTRTALDVGVDGIMTNFPYVIIDVLNESGYKDKYRLATYDDNPWETFKK",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0008081",
                "name": "phosphoric diester hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006629",
                "name": "lipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1
        }
    }
}