GET /api/protein/UniProt/C0HLP9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C0HLP9",
"id": "NLTP1_FOEVU",
"source_organism": {
"taxId": "2849586",
"scientificName": "Foeniculum vulgare",
"fullName": "Foeniculum vulgare (Fennel)"
},
"name": "Non-specific lipid-transfer protein 1",
"description": [
"Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes (By similarity). May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). Binds to both saturated and unsaturated lipids, with the highest binding efficiency for linoleic acid, followed by linolenic acid (PubMed:33277525)"
],
"length": 91,
"sequence": "AIDCKTVDAALVPCVPYLTGGGTPTTQCCSGVSSIKTMAGTPQDKKDACNCVKAAANRYPNIRDDVAQALPVKCNVQLDIPVSRTTNCDAI",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0008289",
"name": "lipid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006869",
"name": "lipid transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6a7adb097b91ab299c5131e16e3c2dca19fb6e23",
"counters": {
"domain_architectures": 15301,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 15301
}
}
}